PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010087232.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family GRAS
Protein Properties Length: 607aa    MW: 69231.6 Da    PI: 6.5942
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010087232.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS271.92e-832276051374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetsekn........sseelaal..... 81 
                     lv+ Ll++Ae v  +++ +a++lL++ + +a+++ +p++R++a+f+ AL++r+ r+  +++++  +p++             +            
  XP_010087232.1 227 LVHILLAAAEKVGFQQFDRATRLLQNCEVIAASRSNPVERVVAVFAGALRERIERENGSMFNSStRPKR----VvfveknlaE------Ndeitq 311
                     689****************************************************55444433213332....2221122331......133334 PP

            GRAS  82 ....kl....fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLak 167
                         +l    +++  P+l++ ++ a qaI+e++e ++++H iD++i  G+QW  L+qaLa+R+e p   l+iT++g      k+++eet++rL +
  XP_010087232.1 312 glstNLatlrYHQQVPFLQVMQFPAIQAIVESFEPATKLHLIDLEIRSGIQWTGLMQALAAREERPIeLLKITAIGV---RGKQKIEETRKRLVS 403
                     4444225668*****************************************************6665499*******...589************ PP

            GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                     +Ae+l++ f+fn+++++++ed++ e ++++++E+++V+++l l ++l ++++le+    +++++++l+P ++vv+e eadhns+sF++rf+e l 
  XP_010087232.1 404 LAESLNLLFSFNAVIVSDMEDIKEELFEIDRNETVIVHSSLFLRTMLWRPHCLEK----LMRVIRNLRPSMMVVAEVEADHNSPSFARRFIEVLF 494
                     *****************************************************99....************************************ PP

            GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                     +y+a+fd+le+ + + ++ r+++E+  l+  i+n+va+e +er+ r+ + + Wr+ ++++G+ +++ls++   qa+l+ ++++ ++  ++e + +
  XP_010087232.1 495 FYAAFFDCLETCI-NLEDFRTTMEEI-LAVGIKNMVATERSERIYRNVRINVWRAFFTRFGMVEIKLSDSSHYQASLVAKQFGcGNSCTLERNGK 587
                     ***********97.677899999999.99******************************************************9999******** PP

            GRAS 357 slvlgWkdrpLvsvSaWr 374
                     +l+ gWk+ ++ s+SaW+
  XP_010087232.1 588 CLMVGWKGTAIHSFSAWK 605
                     *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.019201584IPR005202Transcription factor GRAS
PfamPF035146.8E-81227605IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MANDHHSFYL SSPFNFDEIQ GGNYVPISDH HQDEEPIFSV NKAKNDHLLG LEDHGDHDLS  60
VDYHQYGNNF TGQKGQADHQ FSKDQDQQQQ RSIFDDFDTS SIFLPTQPTE EISTSSTFST  120
THNIVEAIKQ KPIQTPLSSL KLLSNNRNAF NKLKIENFIT KLPQSSSYNK TYSLRQKLST  180
EDIVRIAGAR YIQFSDQGNY HGYCTPLHPF GCALSGLSDG ETKDVELVHI LLAAAEKVGF  240
QQFDRATRLL QNCEVIAASR SNPVERVVAV FAGALRERIE RENGSMFNSS TRPKRVVFVE  300
KNLAENDEIT QGLSTNLATL RYHQQVPFLQ VMQFPAIQAI VESFEPATKL HLIDLEIRSG  360
IQWTGLMQAL AAREERPIEL LKITAIGVRG KQKIEETRKR LVSLAESLNL LFSFNAVIVS  420
DMEDIKEELF EIDRNETVIV HSSLFLRTML WRPHCLEKLM RVIRNLRPSM MVVAEVEADH  480
NSPSFARRFI EVLFFYAAFF DCLETCINLE DFRTTMEEIL AVGIKNMVAT ERSERIYRNV  540
RINVWRAFFT RFGMVEIKLS DSSHYQASLV AKQFGCGNSC TLERNGKCLM VGWKGTAIHS  600
FSAWKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-2225060526375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087232.10.0hypothetical protein L484_009741
TrEMBLW9QJV00.0W9QJV0_9R
STRINGPOPTR_0014s11510.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.12e-56GRAS family protein